PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100017900131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family NAC
Protein Properties Length: 242aa    MW: 27794.1 Da    PI: 7.0469
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100017900131genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM130.71.1e-4061351127
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyat.gkrknrat 78 
                                   +p+GfrF Pt+eelv++yL++k+++++ e+++vi+ ++iy+++P+dLp+      e ++w+fFs r+++++t g r+nr t
  Ote100017900131|100017900131   6 VPKGFRFYPTEEELVSFYLHNKLHRTRPEIDRVIPLLHIYDYNPSDLPRgeYSPVEGEQWFFFSGREERETTrGGRPNRLT 86 
                                   589***************************999***************5334444888******99988876599****** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                                   k gyWkatg+  +v+s+ ++++g k+t+vfy+grap+g+kt W m ey+
  Ote100017900131|100017900131  87 KWGYWKATGSPGDVYSSLNRVIGRKRTMVFYEGRAPHGTKTAWKMIEYK 135
                                   *****************99*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-424155IPR003441NAC domain
PROSITE profilePS5100544.5876156IPR003441NAC domain
PfamPF023652.1E-207135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEEEQVPKGF RFYPTEEELV SFYLHNKLHR TRPEIDRVIP LLHIYDYNPS DLPRGEYSPV  60
EGEQWFFFSG REERETTRGG RPNRLTKWGY WKATGSPGDV YSSLNRVIGR KRTMVFYEGR  120
APHGTKTAWK MIEYKAFSGS PPELREEVCL CRIYKLSKSL RAFDRRPPPV AVGGDEAGTQ  180
QNEATAFNIS AVVPEITDSS SSGDSSAAAD LHRFVKSWSD RRPENPSDGG EIFWDCARLN  240
WF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-25115912168NO APICAL MERISTEM PROTEIN
1ut4_B8e-25115912168NO APICAL MERISTEM PROTEIN
1ut7_A8e-25115912168NO APICAL MERISTEM PROTEIN
1ut7_B8e-25115912168NO APICAL MERISTEM PROTEIN
3swm_A9e-25115915171NAC domain-containing protein 19
3swm_B9e-25115915171NAC domain-containing protein 19
3swm_C9e-25115915171NAC domain-containing protein 19
3swm_D9e-25115915171NAC domain-containing protein 19
3swp_A9e-25115915171NAC domain-containing protein 19
3swp_B9e-25115915171NAC domain-containing protein 19
3swp_C9e-25115915171NAC domain-containing protein 19
3swp_D9e-25115915171NAC domain-containing protein 19
4dul_A8e-25115912168NAC domain-containing protein 19
4dul_B8e-25115912168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553602.13e-72PREDICTED: NAC domain-containing protein 90-like
TrEMBLA0A068UQS72e-73A0A068UQS7_COFCA; Uncharacterized protein
STRINGGLYMA19G38211.19e-72(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357